PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G143100.2.p
Common NameSb01g012460, SORBIDRAFT_01g012460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB_related
Protein Properties Length: 190aa    MW: 20462.4 Da    PI: 10.7239
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G143100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.5e-142670147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          r rWT++E++++++a  ++G + Wk++ + +  ++t+ q++s+ qk+
  Sobic.001G143100.2.p 26 RERWTADEHDRFLHALLLFGRD-WKRVQAFVA-TKTGTQIRSHAQKH 70
                          78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2872175IPR017930Myb domain
SuperFamilySSF466893.36E-152176IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-152573IPR006447Myb domain, plants
SMARTSM007172.8E-92573IPR001005SANT/Myb domain
PfamPF002492.7E-112670IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-72670IPR009057Homeodomain-like
CDDcd001678.19E-82871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MAAAAKSSAG TAVKKCRKPY VMTRPRERWT ADEHDRFLHA LLLFGRDWKR VQAFVATKTG  60
TQIRSHAQKH FLRAEKKLGL AAAAAAAAPH PRTSAGAGAG PGHRQQRPLS TGWCADDDGA  120
SAPDVETVRL PLSPDDLRFA QVYRFVGDVF GSGAPRPVEA QLHRLLGADP VIVDTILRVL  180
ANLQDNLSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761863e-91EU976186.1 Zea mays clone 679787 hypothetical protein mRNA, complete cds.
GenBankKJ7282643e-91KJ728264.1 Zea mays clone pUT6541 MYB-related transcription factor (MYBR45) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466695.11e-136hypothetical protein SORBIDRAFT_01g012460
TrEMBLC5WQB41e-136C5WQB4_SORBI; Putative uncharacterized protein Sb01g012460
STRINGSb01g012460.11e-135(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.12e-27MYB_related family protein